PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0041s0160.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRAS
Protein Properties Length: 759aa    MW: 85643.4 Da    PI: 5.3397
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0041s0160.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS365.38.6e-1123857551373
                    GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsev 87 
                             l++lL++cA+avss+d + a++lL+++++++sp gd  qR+a++f+++ +ar+a++++++y al++++      ++ l+a+++++ +
  SapurV1A.0041s0160.1.p 385 LRTLLIQCAQAVSSNDRRTANELLKQIRQHSSPLGDGSQRMAHCFANGFEARMAGTGTQIYTALSTEKWL---AVDMLKAYQAYVSA 468
                             6789*********************************************************999888876...9************* PP

                    GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeel 172
                             +P+ k++ + aN+ Il+ +e+++++HiiDf+i +G+QWp+L+  L+ Rp+gpp+lRiTg++ p+sg   +e+++etg+rLak++e+ 
  SapurV1A.0041s0160.1.p 469 CPFKKMAIIFANHNILKVAEKASTLHIIDFGILYGFQWPPLIYRLSRRPGGPPKLRITGIELPQSGfrPAERVQETGRRLAKYCERY 555
                             *****************************************************************9********************* PP

                    GRAS 173 gvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfle 259
                             +vpfe+n+ +a++++++++++L+++++E+laVn+ ++ ++llde+v ++s+r++vL l+ +++P++++++  + ++n++ F++rf e
  SapurV1A.0041s0160.1.p 556 NVPFEYNA-IAQKWDTIQIDDLKINRDEVLAVNCLFRFKNLLDETVVVNSPRNAVLTLISKTKPDIFIHAIVNGSYNAPFFVTRFRE 641
                             ********.7***************************************************************************** PP

                    GRAS 260 aleyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvks 346
                             al ++salfd+l++++pre+e r k E+e+ gre++nv+aceg+er+er et+++W+ r ++aG+k++pl+  + k++k+ ++  + 
  SapurV1A.0041s0160.1.p 642 ALFHFSALFDMLDSNMPREDEMRLKFEKEFYGREAMNVIACEGSERVERPETYKQWQVRNMRAGLKQLPLDPCVIKKMKCKVKVSYH 728
                             **************************************************************************************9 PP

                    GRAS 347 dgyrveeesgslvlgWkdrpLvsvSaW 373
                             + + v+ + +++++gWk+r + + SaW
  SapurV1A.0041s0160.1.p 729 EDFVVDGDGHWMLQGWKGRIINASSAW 755
                             99************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.867359736IPR005202Transcription factor GRAS
PfamPF035143.0E-109385755IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009410Biological Processresponse to xenobiotic stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 759 aa     Download sequence    Send to blast
MGSDSRFTEF PGSNKFEDET VFPVSNQYHH VTNGFKLEDS DFDFVENPLV LPDSDPGNSA  60
MSSITSIDED SPSDDNDSEN LLKYINQMLM EEDMEEKPCM FHDPLALQAA ERSFYDILGE  120
KNQPSLLHGS SYGDQFLVDS PDDGFRSSRS DYSSNKSSFP NSVSSVDPQG NGEFGEIKPL  180
FMQMPLPNNF VFQSAANLSS DSFFKLLDGF GSNDDSATKP SAGNIVAPNL FHDTDLALQF  240
KRGVEEASKF LPKGNPLIID LESNALSPEM NRNAPKVAVK AEKEDREYSP EWLTGKKNHE  300
REDGDFEEER SNKQSAVHVD ESELSEMFDT LVGVGEGCRT PRCILDQAEQ CESSKTVRQN  360
RQTKGSSVSK TRAKRRGDNK EVVDLRTLLI QCAQAVSSND RRTANELLKQ IRQHSSPLGD  420
GSQRMAHCFA NGFEARMAGT GTQIYTALST EKWLAVDMLK AYQAYVSACP FKKMAIIFAN  480
HNILKVAEKA STLHIIDFGI LYGFQWPPLI YRLSRRPGGP PKLRITGIEL PQSGFRPAER  540
VQETGRRLAK YCERYNVPFE YNAIAQKWDT IQIDDLKINR DEVLAVNCLF RFKNLLDETV  600
VVNSPRNAVL TLISKTKPDI FIHAIVNGSY NAPFFVTRFR EALFHFSALF DMLDSNMPRE  660
DEMRLKFEKE FYGREAMNVI ACEGSERVER PETYKQWQVR NMRAGLKQLP LDPCVIKKMK  720
CKVKVSYHED FVVDGDGHWM LQGWKGRIIN ASSAWIPA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-403897118328GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2089320.0AC208932.1 Populus trichocarpa clone JGIACSB1081-D10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002299867.10.0hypothetical protein POPTR_0001s24850g
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLB9GJM10.0B9GJM1_POPTR; Uncharacterized protein
STRINGPOPTR_0001s24850.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14